Overview
Teaching: 10 min
Exercises: 15 minQuestions
How can programs do different things for different data?
Objectives
Correctly write programs that use if and else statements and simple Boolean expressions (without logical operators).
Trace the execution of unnested conditionals and conditionals inside loops.
if statements to control whether or not a block of code is executed.if statement (more properly called a conditional statement)
controls whether some block of code is executed or not.for statement:
if and ends with a colonmass = 3.54
if mass > 3.0:
print(mass, 'is large')
mass = 2.07
if mass > 3.0:
print (mass, 'is large')
3.54 is large
masses = [3.54, 2.07, 9.22, 1.86, 1.71]
for m in masses:
if m > 3.0:
print(m, 'is large')
3.54 is large
9.22 is large
else to execute a block of code when an if condition is not true.else can be used following an if.if branch isn’t taken.masses = [3.54, 2.07, 9.22, 1.86, 1.71]
for m in masses:
if m > 3.0:
print(m, 'is large')
else:
print(m, 'is small')
3.54 is large
2.07 is small
9.22 is large
1.86 is small
1.71 is small
elif to specify additional tests.elif (short for “else if”) and a condition to specify these.if.else (which is the “catch all”).masses = [3.54, 2.07, 9.22, 1.86, 1.71]
for m in masses:
if m > 9.0:
print(m, 'is HUGE')
elif m > 3.0:
print(m, 'is large')
else:
print(m, 'is small')
3.54 is large
2.07 is small
9.22 is HUGE
1.86 is small
1.71 is small
grade = 85
if grade >= 70:
print('grade is C')
elif grade >= 80:
print('grade is B')
elif grade >= 90:
print('grade is A')
grade is C
velocity = 10.0
if velocity > 20.0:
print('moving too fast')
else:
print('adjusting velocity')
velocity = 50.0
adjusting velocity
velocity = 10.0
for i in range(5): # execute the loop 5 times
print(i, ':', velocity)
if velocity > 20.0:
print('moving too fast')
velocity = velocity - 5.0
else:
print('moving too slow')
velocity = velocity + 10.0
print('final velocity:', velocity)
0 : 10.0
moving too slow
1 : 20.0
moving too slow
2 : 30.0
moving too fast
3 : 25.0
moving too fast
4 : 20.0
moving too slow
final velocity: 30.0
print statement outside the body of the loop
to show the final value of velocity,
since its value is updated by the last iteration of the loop.Find the First
Fill in the blanks to create a function that takes a list of numbers as an argument and returns the first negative value in the list. What does your function do if no negative number exists? What if the list is empty?
def first_negative(values): for v in ____: if ____: return ____
Compound Relations Using
and,or, and ParenthesesOften, you want some combination of things to be true. You can combine relations within a conditional using
andandor. Continuing the example above, suppose you havemass = [ 3.54, 2.07, 9.22, 1.86, 1.71] velocity = [10.00, 20.00, 30.00, 25.00, 20.00] i = 0 for i in range(5): if mass[i] > 5 and velocity[i] > 20: print("Fast heavy object. Duck!") elif mass[i] > 2 and mass[i] <= 5 and velocity[i] <= 20: print("Normal traffic") elif mass[i] <= 2 and velocity <= 20: print("Slow light object. Ignore it") else: print("Whoa! Something is up with the data. Check it")Just like with arithmetic, you can and should use parentheses whenever there is possible ambiguity. A good general rule is to always use parentheses when mixing
andandorin the same condition. That is, instead of:if mass[i] <= 2 or mass[i] >= 5 and velocity[i] > 20:write one of these:
if (mass[i] <= 2 or mass[i] >= 5) and velocity[i] > 20: if mass[i] <= 2 or (mass[i] >= 5 and velocity[i] > 20):so it is perfectly clear to a reader (and to Python) what you really mean.
Tracing Execution
What does this program print?
pressure = 71.9 if pressure > 50.0: pressure = 25.0 elif pressure <= 50.0: pressure = 0.0 print(pressure)Hint
The variable ‘
pressure’ is being updated. Is there any logical way that either the ‘if’ or ‘elif’ will not evaluate toTrue? Do you think Python would allow both ‘if’ and ‘elif’ to evaluate toTrue?Solution
answer: 25.0
71.9 is greater than 50.0, so the ‘
if’ statement evaluates toTrue. Once an ‘if’ or ‘elif’ evaluates toTruethe remaining conditionals are skipped, so even though pressure is now < 50.0, it is not reassigned to 0.0 in the ‘elif’ statement.
Trimming Values
Fill in the blanks.
The
resultshould be a new list of 1’s and 0’s, where positive values are converted to 1’s, and negative values are converted to 0’s.original = [-1.5, 0.2, 0.4, 0.0, -1.3, 0.4] result = ____ for value in original: if ____: result.append(0) else: ____ print(result)# Predicted output [0, 1, 1, 1, 0, 1]Solution
original = [-1.5, 0.2, 0.4, 0.0, -1.3, 0.4] result = [] for value in original: if value < 0: result.append(0) else: result.append(1) print(result)
Initializing
Fill in the blanks.
This function should find the largest and smallest values in a list.
def min_max(values): smallest, largest = None, None for v in values: if ____: smallest, largest = v, v ____: smallest = min(____, v) largest = max(____, v) return ____ print(min_max([...some test data...]))Hint
What does ‘
None’ resolve to if evaluated in a conditional?The ‘
if’ statement should only execute on the first iteration of the for-loopDon’t forget to add some actual numbers to the list passed to min_max()!
Solution
def min_max(values): smallest, largest = None, None # Initialize some variables but don't set any actual values (you don't know what the `values` list will contain a priori) for v in values: if not smallest: # `None` evaluates to `False`, so the 'double negative' evalutes to `True` on the first pass through the for-loop smallest, largest = v, v # Now it's time to set actual values to `smallest` and `largest` else: # After the first pass through the loop, every `v` will be checked against the current min and max smallest = min(smallest, v) largest = max(largest, v) return smallest, largest print(min_max([...some test data...]))
Bring it all together by processing a FASTA file
The FASTA format specification consists of a header, prefixed with a greater-than symbol (>), that contains the sequence IDs and space-separated metadata, followed by the sequence data on one or more subsequent lines.
Use nano to open up the FASTA file in the ‘sequences’ directory.
$: nano swc-data/sequences/pannexins.faGNU nano 2.2.6 File: swc-data/sequence/pannexins.fa >Dme-Panx1 FBgn0004646 dmInx1. MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVP PHVVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQA MACYTPKFLWNKFEGGLMRMIVMGLNITICTREEKEAKRDALLDYLIKHVKRHKLYAIRY WACEFLCCINIIVQMYLMNRFFDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTF HKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWILLVLLIGLIVFRGCIIFMPKFRP RLLNASNRMIPMEICRSLSRKLDIGDWWLIYMLGRNLDPVIYKDVMSEFAKQVEPSKHDR AK >Dme-Panx2 FBgn0027108 dmInx2. MFDVFGSVKGLLKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIP LGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQA ILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNFYAFRF FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRH ^G Get Help ^O WriteOut ^R Read File ^Y Prev Page ^K Cut Text ^C Cur Pos ^X Exit ^J Justify ^W Where Is ^V Next Page ^U UnCut Text ^T To Spell
For the following exercise write a program that will print only the IDs from the Drosophila melanogaster (Dme) sequences, like this:Dme-Panx1 Dme-Panx2 Dme-Panx3 Dme-Panx4 Dme-Panx5 Dme-Panx6 Dme-Panx7 Dme-Panx8
To read the file into your program, use the following code snippet:with open("pannexins.fa", "r") as ifile: lines = ifile.readlines()
The ‘readlines()’ function will create a new list and then append each line in the file to that list.NOTE: This is NOT the recommended solution for very large files, because readlines() stores everything in the file in memory.
Solution
# Read the file into a list with open("pannexins.fa", "r") as ifile: lines = ifile.readlines() # Loop over every line, searching for the header lines for line in lines: # Confirm that the line is a header, not sequence if line[0] == ">": # 'split' the string into a list on the space (" ") character line_split = line.split(" ") # The sequence ID is the first index of the header list seq_id = line_split[0] # Remove the leading > symbol from the ID seq_id = seq_id[1:] # Test if the first three characters of the ID are "Dme" if seq_id[:3] == "Dme": print(seq_id)
Key Points
Use
ifstatements to control whether or not a block of code is executed.Conditionals are often used inside loops.
Use
elseto execute a block of code when anifcondition is not true.Use
elifto specify additional tests.Conditions are tested once, in order.